Lineage for d1g9aa2 (1g9a A:1080-1290)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126115Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1126522Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 1126579Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
    overall fold is very similar to that of the STI family
  6. 1126580Protein Botulinum neurotoxin [50402] (2 species)
  7. 1126583Species Clostridium botulinum, serotype B [TaxId:1491] [50404] (16 PDB entries)
  8. 1126589Domain d1g9aa2: 1g9a A:1080-1290 [76201]
    Other proteins in same PDB: d1g9aa1, d1g9aa3, d1g9aa4
    complexed with bab, zn

Details for d1g9aa2

PDB Entry: 1g9a (more details), 2.1 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with an inhibitor (experiment 3)
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d1g9aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9aa2 b.42.4.2 (A:1080-1290) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
seylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdly
igekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisd
sdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcis
kwylkevkrkpynlklgcnwqfipkdegwte

SCOPe Domain Coordinates for d1g9aa2:

Click to download the PDB-style file with coordinates for d1g9aa2.
(The format of our PDB-style files is described here.)

Timeline for d1g9aa2: