Lineage for d1eaoa_ (1eao A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040931Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2041295Family b.2.5.6: RUNT domain [81318] (2 proteins)
    automatically mapped to Pfam PF00853
  6. 2041296Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 2041310Species Mouse (Mus musculus) [TaxId:10090] [63684] (14 PDB entries)
    almost identical sequence to the human protein
  8. 2041313Domain d1eaoa_: 1eao A: [76142]
    complexed with br

Details for d1eaoa_

PDB Entry: 1eao (more details), 1.4 Å

PDB Description: the runx1 runt domain at 1.4a resolution: a structural switch and specifically bound chloride ions modulate dna binding
PDB Compounds: (A:) runt-related transcription factor 1

SCOPe Domain Sequences for d1eaoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eaoa_ b.2.5.6 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus) [TaxId: 10090]}
smvevladhpgelvrtdspnflssvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagn
denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikit
vdgp

SCOPe Domain Coordinates for d1eaoa_:

Click to download the PDB-style file with coordinates for d1eaoa_.
(The format of our PDB-style files is described here.)

Timeline for d1eaoa_: