SCOPe 2.05: Domain d1eaoa_: 1eao A:

Lineage for d1eaoa_ (1eao A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.6: RUNT domain [81318] (2 proteins)
   automatically mapped to Pfam PF00853

6. Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
   synonym: core binding factor alpha, cbfa

7. Species Mouse (Mus musculus) [TaxId:10090] [63684] (14 PDB entries)
   almost identical sequence to the human protein

8. Domain d1eaoa_: 1eao A: [76142]
   complexed with br

Details for d1eaoa_

PDB Entry: 1eao, 1.4 Å

PDB Description: the runx1 runt domain at 1.4a resolution: a structural switch and specifically bound chloride ions modulate dna binding

PDB Compounds: (A:) runt-related transcription factor 1

SCOPe Domain Sequences for d1eaoa_:

Sequence; same for both SEQRES and ATOM records:

>d1eaoa_ b.2.5.6 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus) [TaxId: 10090]}
smvevladhpgelvrtdspnflssvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagn
denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikit
vdgp

Timeline for d1eaoa_:

• d1eaoa_ first appeared in SCOP 1.63
  
• d1eaoa_ appears in SCOPe 2.04
  
• d1eaoa_ appears in SCOPe 2.06
  
• d1eaoa_ appears in the current release, SCOPe 2.08