Lineage for d9icqa4 (9icq A:149-335)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239280Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2239281Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2239289Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2239290Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 2239291Species Human (Homo sapiens) [TaxId:9606] [81574] (145 PDB entries)
    Uniprot P06746
  8. 2239369Domain d9icqa4: 9icq A:149-335 [76118]
    Other proteins in same PDB: d9icqa1, d9icqa3
    protein/DNA complex; complexed with dtp, mn, na

Details for d9icqa4

PDB Entry: 9icq (more details), 2.9 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with six base pairs of dna; soaked in the presence of datp (1 millimolar) and mncl2 (5 millimolar)
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d9icqa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icqa4 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOPe Domain Coordinates for d9icqa4:

Click to download the PDB-style file with coordinates for d9icqa4.
(The format of our PDB-style files is described here.)

Timeline for d9icqa4: