Lineage for d9icqa4 (9icq A:149-335)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265789Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 265790Superfamily d.218.1: Nucleotidyltransferase [81301] (4 families) (S)
  5. 265798Family d.218.1.2: DNA polymerase beta-like [81300] (3 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 265799Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 265800Species Human (Homo sapiens) [TaxId:9606] [81574] (92 PDB entries)
  8. 265835Domain d9icqa4: 9icq A:149-335 [76118]
    Other proteins in same PDB: d9icqa1, d9icqa3
    protein/DNA complex; complexed with dtp, mn, na

Details for d9icqa4

PDB Entry: 9icq (more details), 2.9 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with six base pairs of dna; soaked in the presence of datp (1 millimolar) and mncl2 (5 millimolar)

SCOP Domain Sequences for d9icqa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icqa4 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens)}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOP Domain Coordinates for d9icqa4:

Click to download the PDB-style file with coordinates for d9icqa4.
(The format of our PDB-style files is described here.)

Timeline for d9icqa4: