Class b: All beta proteins [48724] (119 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) a distorted variant of double-helix |
Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein) |
Protein Calcium ATPase, transduction domain A [81651] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (3 PDB entries) |
Domain d1iwoa1: 1iwo A:125-239 [75854] Other proteins in same PDB: d1iwoa2, d1iwoa3, d1iwoa4, d1iwob2, d1iwob3, d1iwob4 |
PDB Entry: 1iwo (more details), 3.1 Å
SCOP Domain Sequences for d1iwoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwoa1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus)} emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm
Timeline for d1iwoa1:
View in 3D Domains from other chains: (mouse over for more information) d1iwob1, d1iwob2, d1iwob3, d1iwob4 |