SCOP 1.63: Domain d1huzb3: 1huz B:92-148

Lineage for d1huzb3 (1huz B:92-148)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins)
   topological similarity to the N-terminal domain

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (17 PDB entries)

8. Domain d1huzb3: 1huz B:92-148 [75852]
   Other proteins in same PDB: d1huza1, d1huza4, d1huzb1, d1huzb4
   complexed with cr, mdn

Details for d1huzb3

PDB Entry: 1huz, 2.6 Å

PDB Description: crystal structure of dna polymerase complexed with dna and cr-pcp

SCOP Domain Sequences for d1huzb3:

Sequence; same for both SEQRES and ATOM records:

>d1huzb3 a.60.12.1 (B:92-148) DNA polymerase beta {Rat (Rattus norvegicus)}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d1huzb3:

• d1huzb3 is new in SCOP 1.63
  
• d1huzb3 appears in SCOP 1.65
  
• d1huzb3 appears in the current release, SCOPe 2.08