Lineage for d1gaxa4 (1gax A:797-862)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 531983Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 532060Superfamily a.2.7: tRNA-binding arm [46589] (4 families) (S)
    formerly a class II aminoacyl-tRNA synthetase N-domain
  5. 532076Family a.2.7.3: Valyl-tRNA synthetase (ValRS) C-terminal domain [81635] (1 protein)
  6. 532077Protein Valyl-tRNA synthetase (ValRS) C-terminal domain [81634] (1 species)
  7. 532078Species Thermus thermophilus [TaxId:274] [81633] (3 PDB entries)
  8. 532081Domain d1gaxa4: 1gax A:797-862 [75842]
    Other proteins in same PDB: d1gaxa2, d1gaxa3, d1gaxa5, d1gaxb2, d1gaxb3, d1gaxb5

Details for d1gaxa4

PDB Entry: 1gax (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus valyl-trna synthetase complexed with trna(val) and valyl-adenylate analogue

SCOP Domain Sequences for d1gaxa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaxa4 a.2.7.3 (A:797-862) Valyl-tRNA synthetase (ValRS) C-terminal domain {Thermus thermophilus}
dveewrrrqekrlkellalaersqrklaspgfrekapkevveaeearlkenleqaerire
alsqig

SCOP Domain Coordinates for d1gaxa4:

Click to download the PDB-style file with coordinates for d1gaxa4.
(The format of our PDB-style files is described here.)

Timeline for d1gaxa4: