Lineage for d1gaxa3 (1gax A:1-189,A:343-578)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 579981Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 579982Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 579983Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 580117Protein Valyl-tRNA synthetase (ValRS) [52390] (1 species)
  7. 580118Species Thermus thermophilus [TaxId:274] [52391] (3 PDB entries)
  8. 580121Domain d1gaxa3: 1gax A:1-189,A:343-578 [31595]
    Other proteins in same PDB: d1gaxa2, d1gaxa4, d1gaxa5, d1gaxb2, d1gaxb4, d1gaxb5

Details for d1gaxa3

PDB Entry: 1gax (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus valyl-trna synthetase complexed with trna(val) and valyl-adenylate analogue

SCOP Domain Sequences for d1gaxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaxa3 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus}
mdlpkaydpksvepkwaekwaknpfvanpksgkppfvifmpppnvtgslhmghaldnslq
dalirykrmrgfeavwlpgtdhagiatqvvverlllkegktrhdlgrekflervwqwkee
sggtilkqlkrlgasadwsreaftmdekrsravryafsryyheglayraprlvnwcprce
ttlsdleveXtcsrcgtpieyaifpqwwlrmrplaeevlkglrrgdiafvperwkkvnmd
wlenvkdwnisrqlwwghqipawycedcqavnvprperyledptsceacgsprlkrdedv
fdtwfssalwplstlgwpeetedlkafypgdvlvtgydilflwvsrmevsgyhfmgerpf
ktvllhglvldekgqkmskskgnvidplemverygadalrfaliylatggqdirldlrwl
emarnf

SCOP Domain Coordinates for d1gaxa3:

Click to download the PDB-style file with coordinates for d1gaxa3.
(The format of our PDB-style files is described here.)

Timeline for d1gaxa3: