Lineage for d1md4b1 (1md4 B:77-209)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 915887Protein Class pi GST [81347] (4 species)
  7. 915888Species Human (Homo sapiens) [TaxId:9606] [47619] (41 PDB entries)
  8. 915928Domain d1md4b1: 1md4 B:77-209 [74634]
    Other proteins in same PDB: d1md4a2, d1md4b2
    complexed with gsh, mes; mutant

Details for d1md4b1

PDB Entry: 1md4 (more details), 2.1 Å

PDB Description: a folding mutant of human class pi glutathione transferase, created by mutating glycine 146 of the wild-type protein to valine
PDB Compounds: (B:) pi glutathione transferase

SCOPe Domain Sequences for d1md4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1md4b1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivvdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d1md4b1:

Click to download the PDB-style file with coordinates for d1md4b1.
(The format of our PDB-style files is described here.)

Timeline for d1md4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1md4b2