Lineage for d1m9ub_ (1m9u B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1545908Protein Elastase [50536] (4 species)
  7. 1546038Species Worm (Eisenia fetida) [TaxId:6396] [74973] (1 PDB entry)
    fibrinolytic enzyme component A
  8. 1546040Domain d1m9ub_: 1m9u B: [74602]

Details for d1m9ub_

PDB Entry: 1m9u (more details), 2.3 Å

PDB Description: Crystal Structure of Earthworm Fibrinolytic Enzyme Component A from Eisenia fetida
PDB Compounds: (B:) Earthworm Fibrinolytic Enzyme

SCOPe Domain Sequences for d1m9ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9ub_ b.47.1.2 (B:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]}
viggtnaspgefpwqlsqqrqsgswshscgasllsstsalsashcvdgvlpnnirviagl
wqqsdtsgtqtanvdsytmhenygagtasysndiailhlatsislggniqaavlpannnn
dyagttcvisgwgrtdgtnnlpdilqkssipvittaqctaamvgvgganiwdnhicvqdp
agntgacngdsggplncpdggtrvvgvtswvvssglgaclpdypsvytrvsaylgwigdn
s

SCOPe Domain Coordinates for d1m9ub_:

Click to download the PDB-style file with coordinates for d1m9ub_.
(The format of our PDB-style files is described here.)

Timeline for d1m9ub_: