Lineage for d1m9ub_ (1m9u B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056282Protein Elastase [50536] (4 species)
  7. 2056419Species Worm (Eisenia fetida) [TaxId:6396] [74973] (2 PDB entries)
    fibrinolytic enzyme component A
  8. 2056424Domain d1m9ub_: 1m9u B: [74602]

Details for d1m9ub_

PDB Entry: 1m9u (more details), 2.3 Å

PDB Description: Crystal Structure of Earthworm Fibrinolytic Enzyme Component A from Eisenia fetida
PDB Compounds: (B:) Earthworm Fibrinolytic Enzyme

SCOPe Domain Sequences for d1m9ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9ub_ b.47.1.2 (B:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]}
viggtnaspgefpwqlsqqrqsgswshscgasllsstsalsashcvdgvlpnnirviagl
wqqsdtsgtqtanvdsytmhenygagtasysndiailhlatsislggniqaavlpannnn
dyagttcvisgwgrtdgtnnlpdilqkssipvittaqctaamvgvgganiwdnhicvqdp
agntgacngdsggplncpdggtrvvgvtswvvssglgaclpdypsvytrvsaylgwigdn
s

SCOPe Domain Coordinates for d1m9ub_:

Click to download the PDB-style file with coordinates for d1m9ub_.
(The format of our PDB-style files is described here.)

Timeline for d1m9ub_: