Lineage for d1m8ab_ (1m8a B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1193305Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1193306Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1193307Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1193375Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 1193405Species Human (Homo sapiens), ccl20/mip-3a [TaxId:9606] [75340] (3 PDB entries)
  8. 1193407Domain d1m8ab_: 1m8a B: [74580]
    complexed with ipa

Details for d1m8ab_

PDB Entry: 1m8a (more details), 1.7 Å

PDB Description: Human MIP-3alpha/CCL20
PDB Compounds: (B:) Small inducible cytokine A20

SCOPe Domain Sequences for d1m8ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8ab_ d.9.1.1 (B:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), ccl20/mip-3a [TaxId: 9606]}
dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrlls
k

SCOPe Domain Coordinates for d1m8ab_:

Click to download the PDB-style file with coordinates for d1m8ab_.
(The format of our PDB-style files is described here.)

Timeline for d1m8ab_: