Lineage for d1m6ve2 (1m6v E:936-1073)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118472Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2118473Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 2118474Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 2118475Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 2118476Species Escherichia coli [TaxId:562] [52338] (10 PDB entries)
    Uniprot P00968
  8. 2118507Domain d1m6ve2: 1m6v E:936-1073 [74553]
    Other proteins in same PDB: d1m6va1, d1m6va3, d1m6va4, d1m6va5, d1m6va6, d1m6vb1, d1m6vb2, d1m6vc1, d1m6vc3, d1m6vc4, d1m6vc5, d1m6vc6, d1m6vd1, d1m6vd2, d1m6ve1, d1m6ve3, d1m6ve4, d1m6ve5, d1m6ve6, d1m6vf1, d1m6vf2, d1m6vg1, d1m6vg3, d1m6vg4, d1m6vg5, d1m6vg6, d1m6vh1, d1m6vh2
    complexed with adp, cl, k, mn, net, orn, po4; mutant

Details for d1m6ve2

PDB Entry: 1m6v (more details), 2.1 Å

PDB Description: crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase
PDB Compounds: (E:) carbamoyl phosphate synthetase large chain

SCOPe Domain Sequences for d1m6ve2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ve2 c.24.1.1 (E:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOPe Domain Coordinates for d1m6ve2:

Click to download the PDB-style file with coordinates for d1m6ve2.
(The format of our PDB-style files is described here.)

Timeline for d1m6ve2: