Lineage for d1m6vg5 (1m6v G:128-402)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217297Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2217358Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 2217359Species Escherichia coli [TaxId:562] [56077] (10 PDB entries)
    Uniprot P00968
  8. 2217422Domain d1m6vg5: 1m6v G:128-402 [74564]
    Other proteins in same PDB: d1m6va1, d1m6va2, d1m6va3, d1m6va4, d1m6vb1, d1m6vb2, d1m6vc1, d1m6vc2, d1m6vc3, d1m6vc4, d1m6vd1, d1m6vd2, d1m6ve1, d1m6ve2, d1m6ve3, d1m6ve4, d1m6vf1, d1m6vf2, d1m6vg1, d1m6vg2, d1m6vg3, d1m6vg4, d1m6vh1, d1m6vh2
    complexed with adp, cl, k, mn, net, orn, po4; mutant

Details for d1m6vg5

PDB Entry: 1m6v (more details), 2.1 Å

PDB Description: crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase
PDB Compounds: (G:) carbamoyl phosphate synthetase large chain

SCOPe Domain Sequences for d1m6vg5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6vg5 d.142.1.2 (G:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]}
drrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsgggiaynree
feeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdamgihtgds
itvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviemnprvsrs
salaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkiprfnfekf
agandrlttqmksvgevmaigrtqqeslqkalrgl

SCOPe Domain Coordinates for d1m6vg5:

Click to download the PDB-style file with coordinates for d1m6vg5.
(The format of our PDB-style files is described here.)

Timeline for d1m6vg5: