![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.7: BAG domain [63491] (1 family) ![]() |
![]() | Family a.7.7.1: BAG domain [63492] (4 proteins) Pfam PF02179 this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain |
![]() | Protein Silencer of death domains, Sodd (Bag4) [74699] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74700] (2 PDB entries) |
![]() | Domain d1m62a_: 1m62 A: [74520] |
PDB Entry: 1m62 (more details)
SCOPe Domain Sequences for d1m62a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m62a_ a.7.7.1 (A:) Silencer of death domains, Sodd (Bag4) {Human (Homo sapiens) [TaxId: 9606]} gspeftppsikkiihvlekvqyleqeveefvgkktdkaywlleemltkelleldsvetgg qdsvrqarkeavckiqaileklekkgl
Timeline for d1m62a_: