PDB entry 1m62

View 1m62 on RCSB PDB site
Description: Solution structure of the BAG domain from BAG4/SODD
Class: chaperone
Keywords: BAG domain, BAG4, SODD, Silencer of Death Domains, Hsp70/Hsc70 co-chaperone
Deposited on 2002-07-11, released 2002-07-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BAG-family molecular chaperone regulator-4
    Species: Homo sapiens [TaxId:9606]
    Gene: BAG4/SODD
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95429 (5-86)
      • cloning artifact (0-4)
    Domains in SCOPe 2.02: d1m62a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m62A (A:)
    gspeftppsikkiihvlekvqyleqeveefvgkktdkaywlleemltkelleldsvetgg
    qdsvrqarkeavckiqaileklekkgl