Lineage for d1m5sc2 (1m5s C:2146-2297)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029983Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family) (S)
    duplication: contains two subdomains of this fold
  5. 1029984Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
  6. 1029985Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)
  7. 1030028Species Methanosarcina barkeri [TaxId:2208] [75458] (1 PDB entry)
  8. 1030034Domain d1m5sc2: 1m5s C:2146-2297 [74516]

Details for d1m5sc2

PDB Entry: 1m5s (more details), 1.85 Å

PDB Description: Formylmethanofuran:tetrahydromethanopterin fromyltransferase from Methanosarcina barkeri
PDB Compounds: (C:) Formylmethanofuran--tetrahydromethanopterin formyltransferase

SCOPe Domain Sequences for d1m5sc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5sc2 d.58.33.1 (C:2146-2297) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Methanosarcina barkeri [TaxId: 2208]}
egdflaeenigaiagiaggnffifgdsqmtaltaaeaavdtiaelegtitpfpggivasg
sksgankykflkatanerfcpsikdkienteipadvnavyeivingldeesikaamkagi
kaavtvpgvkkisagnyggklgkyqfklhelf

SCOPe Domain Coordinates for d1m5sc2:

Click to download the PDB-style file with coordinates for d1m5sc2.
(The format of our PDB-style files is described here.)

Timeline for d1m5sc2: