SCOPe 2.08: Domain d1m5sc2: 1m5s C:2146-2297

Lineage for d1m5sc2 (1m5s C:2146-2297)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (2 families)
   duplication: contains two subdomains of this fold

5. Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)

6. Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)

7. Species Methanosarcina barkeri [TaxId:2208] [75458] (1 PDB entry)

8. Domain d1m5sc2: 1m5s C:2146-2297 [74516]

Details for d1m5sc2

PDB Entry: 1m5s, 1.85 Å

PDB Description: Formylmethanofuran:tetrahydromethanopterin fromyltransferase from Methanosarcina barkeri

PDB Compounds: (C:) Formylmethanofuran--tetrahydromethanopterin formyltransferase

SCOPe Domain Sequences for d1m5sc2:

Sequence; same for both SEQRES and ATOM records:

>d1m5sc2 d.58.33.1 (C:2146-2297) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Methanosarcina barkeri [TaxId: 2208]}
egdflaeenigaiagiaggnffifgdsqmtaltaaeaavdtiaelegtitpfpggivasg
sksgankykflkatanerfcpsikdkienteipadvnavyeivingldeesikaamkagi
kaavtvpgvkkisagnyggklgkyqfklhelf

Timeline for d1m5sc2:

• d1m5sc2 first appeared in SCOP 1.61
  
• d1m5sc2 appears in SCOPe 2.07