Lineage for d1m57c_ (1m57 C:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1238962Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 1238963Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
  5. 1238964Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 1238965Protein Bacterial aa3 type cytochrome c oxidase subunit III [81448] (2 species)
  7. 1238968Species Rhodobacter sphaeroides [TaxId:1063] [81447] (2 PDB entries)
  8. 1238971Domain d1m57c_: 1m57 C: [74484]
    Other proteins in same PDB: d1m57a_, d1m57b1, d1m57b2, d1m57d_, d1m57g_, d1m57h1, d1m57h2, d1m57j_
    complexed with ca, cu, hea, mg, peh; mutant

Details for d1m57c_

PDB Entry: 1m57 (more details), 3 Å

PDB Description: structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i- 286) mutant))
PDB Compounds: (C:) cytochrome c oxidase

SCOPe Domain Sequences for d1m57c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m57c_ f.25.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit III {Rhodobacter sphaeroides [TaxId: 1063]}
ahaknhdyhilppsiwpfmasvgafvmlfgavlwmhgsgpwmgliglvvvlytmfgwwsd
vvteslegdhtpvvrlglrwgfilfimsevmffsawfwsffkhalypmgpespiidgifp
pegiitfdpwhlplintlillcsgcaatwahhalvhennrrdvawglalaialgalftvf
qayeyshaafgfagniyganffmatgfhgfhvivgtifllvclirvqrghftpekhvgfe
aaiwywhfvdvvwlflfasiyiwgq

SCOPe Domain Coordinates for d1m57c_:

Click to download the PDB-style file with coordinates for d1m57c_.
(The format of our PDB-style files is described here.)

Timeline for d1m57c_: