SCOPe 2.08: Domain d1m57c_: 1m57 C:

Lineage for d1m57c_ (1m57 C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Bacterial aa3 type cytochrome c oxidase subunit III [81448] (2 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81447] (2 PDB entries)

8. Domain d1m57c_: 1m57 C: [74484]
   Other proteins in same PDB: d1m57a_, d1m57b1, d1m57b2, d1m57d_, d1m57g_, d1m57h1, d1m57h2, d1m57j_
   complexed with 3pe, ca, cu, hea, mg; mutant

Details for d1m57c_

PDB Entry: 1m57, 3 Å

PDB Description: structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i- 286) mutant))

PDB Compounds: (C:) cytochrome c oxidase

SCOPe Domain Sequences for d1m57c_:

Sequence; same for both SEQRES and ATOM records:

>d1m57c_ f.25.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit III {Rhodobacter sphaeroides [TaxId: 1063]}
ahaknhdyhilppsiwpfmasvgafvmlfgavlwmhgsgpwmgliglvvvlytmfgwwsd
vvteslegdhtpvvrlglrwgfilfimsevmffsawfwsffkhalypmgpespiidgifp
pegiitfdpwhlplintlillcsgcaatwahhalvhennrrdvawglalaialgalftvf
qayeyshaafgfagniyganffmatgfhgfhvivgtifllvclirvqrghftpekhvgfe
aaiwywhfvdvvwlflfasiyiwgq

Timeline for d1m57c_:

• d1m57c_ first appeared in SCOP 1.61, called d1m57c1
  
• d1m57c_ appears in SCOPe 2.07