Lineage for d1m56d_ (1m56 D:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238332Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family) (S)
  5. 1238333Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (1 protein)
  6. 1238334Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species)
    interacts with subunit I and III, function unknown, non-essential for the enzymatic activity
  7. 1238337Species Rhodobacter sphaeroides [TaxId:1063] [81466] (2 PDB entries)
  8. 1238338Domain d1m56d_: 1m56 D: [74475]
    Other proteins in same PDB: d1m56a_, d1m56b1, d1m56b2, d1m56c_, d1m56g_, d1m56h1, d1m56h2, d1m56i_
    complexed with ca, cu, hea, mg, peh

Details for d1m56d_

PDB Entry: 1m56 (more details), 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
PDB Compounds: (D:) cytochrome c oxidase

SCOPe Domain Sequences for d1m56d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m56d_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Rhodobacter sphaeroides [TaxId: 1063]}
ghvagsmditqqektfagfvrmvtwaavvivaaliflalana

SCOPe Domain Coordinates for d1m56d_:

Click to download the PDB-style file with coordinates for d1m56d_.
(The format of our PDB-style files is described here.)

Timeline for d1m56d_: