Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family) automatically mapped to Pfam PF07835 |
Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (2 proteins) |
Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species) interacts with subunit I and III, function unknown, non-essential for the enzymatic activity |
Species Rhodobacter sphaeroides [TaxId:1063] [81466] (2 PDB entries) |
Domain d1m56d_: 1m56 D: [74475] Other proteins in same PDB: d1m56a_, d1m56b1, d1m56b2, d1m56c_, d1m56g_, d1m56h1, d1m56h2, d1m56i_ complexed with 3pe, ca, cu, hea, mg |
PDB Entry: 1m56 (more details), 2.3 Å
SCOPe Domain Sequences for d1m56d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m56d_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Rhodobacter sphaeroides [TaxId: 1063]} ghvagsmditqqektfagfvrmvtwaavvivaaliflalana
Timeline for d1m56d_: