Lineage for d1m1pf_ (1m1p F:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361613Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 361614Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 361690Family a.138.1.3: Di-heme elbow motif [48711] (6 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 361719Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)
  7. 361741Species Shewanella oneidensis [TaxId:70863] [74808] (3 PDB entries)
  8. 361749Domain d1m1pf_: 1m1p F: [74418]
    complexed with hem, sul

Details for d1m1pf_

PDB Entry: 1m1p (more details), 1.55 Å

PDB Description: p21 crystal structure of the tetraheme cytochrome c3 from shewanella oneidensis mr1

SCOP Domain Sequences for d1m1pf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1pf_ a.138.1.3 (F:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis}
dqklsdfhaesggceschkdgtpsadgafefaqcqschgklsemdavhkphdgnlvcadc
havhdmnvgqkptceschddgrtsasvl

SCOP Domain Coordinates for d1m1pf_:

Click to download the PDB-style file with coordinates for d1m1pf_.
(The format of our PDB-style files is described here.)

Timeline for d1m1pf_: