| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
| Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species) |
| Species Shewanella oneidensis [TaxId:70863] [74808] (3 PDB entries) |
| Domain d1m1pf_: 1m1p F: [74418] |
PDB Entry: 1m1p (more details), 1.55 Å
SCOP Domain Sequences for d1m1pf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1pf_ a.138.1.3 (F:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis}
dqklsdfhaesggceschkdgtpsadgafefaqcqschgklsemdavhkphdgnlvcadc
havhdmnvgqkptceschddgrtsasvl
Timeline for d1m1pf_: