Lineage for d1loma_ (1lom A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 235254Fold b.89: Cyanovirin-N [51321] (1 superfamily)
    complex fold
  4. 235255Superfamily b.89.1: Cyanovirin-N [51322] (1 family) (S)
    duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
  5. 235256Family b.89.1.1: Cyanovirin-N [51323] (1 protein)
  6. 235257Protein Cyanovirin-N [51324] (1 species)
  7. 235258Species Cyanobacterium (Nostoc ellipsosporum) [TaxId:45916] [51325] (11 PDB entries)
  8. 235260Domain d1loma_: 1lom A: [74152]
    swapped dimer
    complexed with ca, so4; mutant

Details for d1loma_

PDB Entry: 1lom (more details), 1.72 Å

PDB Description: cyanovirin-n double mutant p51s s52p

SCOP Domain Sequences for d1loma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1loma_ b.89.1.1 (A:) Cyanovirin-N {Cyanobacterium (Nostoc ellipsosporum)}
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqspnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

SCOP Domain Coordinates for d1loma_:

Click to download the PDB-style file with coordinates for d1loma_.
(The format of our PDB-style files is described here.)

Timeline for d1loma_: