Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.14: Glycogenin [75273] (2 proteins) |
Protein Glycogenin [75274] (2 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [75275] (15 PDB entries) |
Domain d1ll0f_: 1ll0 F: [74000] Other proteins in same PDB: d1ll0b2, d1ll0e2, d1ll0i2 |
PDB Entry: 1ll0 (more details), 3.43 Å
SCOPe Domain Sequences for d1ll0f_:
Sequence, based on SEQRES records: (download)
>d1ll0f_ c.68.1.14 (F:) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm thpqflnvwwdifttsvvpllqqfglv
>d1ll0f_ c.68.1.14 (F:) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsethpqfl nvwwdifttsvvpllqqfglv
Timeline for d1ll0f_: