Lineage for d1ll0f_ (1ll0 F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1868080Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1868081Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1868776Family c.68.1.14: Glycogenin [75273] (2 proteins)
  6. 1868777Protein Glycogenin [75274] (2 species)
  7. 1868798Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [75275] (15 PDB entries)
  8. 1868819Domain d1ll0f_: 1ll0 F: [74000]

Details for d1ll0f_

PDB Entry: 1ll0 (more details), 3.43 Å

PDB Description: Crystal Structure of Rabbit Muscle Glycogenin
PDB Compounds: (F:) glycogenin-1

SCOPe Domain Sequences for d1ll0f_:

Sequence, based on SEQRES records: (download)

>d1ll0f_ c.68.1.14 (F:) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm
thpqflnvwwdifttsvvpllqqfglv

Sequence, based on observed residues (ATOM records): (download)

>d1ll0f_ c.68.1.14 (F:) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsethpqfl
nvwwdifttsvvpllqqfglv

SCOPe Domain Coordinates for d1ll0f_:

Click to download the PDB-style file with coordinates for d1ll0f_.
(The format of our PDB-style files is described here.)

Timeline for d1ll0f_: