![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.14: FliG [48029] (2 families) ![]() fragmented superhelix; consist of 3/4-helical motifs and connecting helices |
![]() | Family a.118.14.1: FliG [48030] (2 proteins) |
![]() | Protein FliG [48031] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [48032] (3 PDB entries) |
![]() | Domain d1lkvx_: 1lkv X: [73980] middle and C-terminal domains complexed with ca |
PDB Entry: 1lkv (more details), 2.8 Å
SCOPe Domain Sequences for d1lkvx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} dpvqlvnflqsehpqtiavvlsyldppvaaqilgalpeelqtevlkriallertspevvk eiernlekkisgfvsrtfskvggidtaaeimnnldrttekkimdklvqenpeladeirrr mfvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeley mgpvrlkdveeaqqkiiniirrleeageiviar
Timeline for d1lkvx_: