Lineage for d1lkvx_ (1lkv X:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727358Superfamily a.118.14: FliG [48029] (2 families) (S)
    fragmented superhelix; consist of 3/4-helical motifs and connecting helices
  5. 2727359Family a.118.14.1: FliG [48030] (2 proteins)
  6. 2727360Protein FliG [48031] (1 species)
  7. 2727361Species Thermotoga maritima [TaxId:2336] [48032] (3 PDB entries)
  8. 2727365Domain d1lkvx_: 1lkv X: [73980]
    middle and C-terminal domains
    complexed with ca

Details for d1lkvx_

PDB Entry: 1lkv (more details), 2.8 Å

PDB Description: crystal structure of the middle and c-terminal domains of the flagellar rotor protein flig
PDB Compounds: (X:) Flagellar motor switch protein fliG

SCOPe Domain Sequences for d1lkvx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]}
dpvqlvnflqsehpqtiavvlsyldppvaaqilgalpeelqtevlkriallertspevvk
eiernlekkisgfvsrtfskvggidtaaeimnnldrttekkimdklvqenpeladeirrr
mfvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeley
mgpvrlkdveeaqqkiiniirrleeageiviar

SCOPe Domain Coordinates for d1lkvx_:

Click to download the PDB-style file with coordinates for d1lkvx_.
(The format of our PDB-style files is described here.)

Timeline for d1lkvx_: