![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.4: D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75176] (1 protein) share a common phosphate-binding site with the NagB-like family; part of sheet is folded upon itself and forms a barrel-like structure like the CoA transferase subunits |
![]() | Protein D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75177] (4 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [75179] (2 PDB entries) |
![]() | Domain d1lk7d1: 1lk7 D:1-130,D:211-229 [73974] Other proteins in same PDB: d1lk7a2, d1lk7b2, d1lk7c2, d1lk7d2 complexed with cl, der, na |
PDB Entry: 1lk7 (more details), 2 Å
SCOPe Domain Sequences for d1lk7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lk7d1 c.124.1.4 (D:1-130,D:211-229) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Pyrococcus horikoshii [TaxId: 53953]} mnveemkkiaakealkfieddmviglgtgsttayfikllgeklkrgeisdivgvptsyqa kllaiehdipiasldqvdaidvavdgadevdpnlnlikgrgaaltmekiieyragtfivl vderklvdylXdiadivivgtregvkkler
Timeline for d1lk7d1: