Lineage for d1lj7j_ (1lj7 J:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226980Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 226981Protein C-reactive protein (CRP) [49954] (1 species)
  7. 226982Species Human (Homo sapiens) [TaxId:9606] [49955] (3 PDB entries)
  8. 226997Domain d1lj7j_: 1lj7 J: [73938]
    calcium-depleted

Details for d1lj7j_

PDB Entry: 1lj7 (more details), 3.15 Å

PDB Description: crystal structure of calcium-depleted human c-reactive protein from perfectly twinned data

SCOP Domain Sequences for d1lj7j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lj7j_ b.29.1.5 (J:) C-reactive protein (CRP) {Human (Homo sapiens)}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

SCOP Domain Coordinates for d1lj7j_:

Click to download the PDB-style file with coordinates for d1lj7j_.
(The format of our PDB-style files is described here.)

Timeline for d1lj7j_: