Lineage for d1lbyb_ (1lby B:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266544Fold e.7: Sugar phosphatases [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 266545Superfamily e.7.1: Sugar phosphatases [56655] (1 family) (S)
  5. 266546Family e.7.1.1: Sugar phosphatases [56656] (6 proteins)
  6. 266555Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (2 species)
  7. 266556Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [75608] (5 PDB entries)
  8. 266562Domain d1lbyb_: 1lby B: [73820]
    complexed with f6p, mn, po4

Details for d1lbyb_

PDB Entry: 1lby (more details), 2.25 Å

PDB Description: crystal structure of a complex (p32 crystal form) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus with 3 manganese ions, fructose-6-phosphate, and phosphate ion

SCOP Domain Sequences for d1lbyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbyb_ e.7.1.1 (B:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Archaeoglobus fulgidus}
mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
eklhpkllelik

SCOP Domain Coordinates for d1lbyb_:

Click to download the PDB-style file with coordinates for d1lbyb_.
(The format of our PDB-style files is described here.)

Timeline for d1lbyb_: