Lineage for d1lbyb_ (1lby B:)
- Root: SCOP 1.61
Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds) 
Fold e.7: Sugar phosphatases [56654] (1 superfamily) Superfamily e.7.1: Sugar phosphatases [56655] (1 family) 
Family e.7.1.1: Sugar phosphatases [56656] (6 proteins) 
Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (2 species) Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [75608] (5 PDB entries) 
Domain d1lbyb_: 1lby B: [73820]
Details for d1lbyb_
PDB Entry: 1lby (more details), 2.25 Å
PDB Description: crystal structure of a complex (p32 crystal form) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus with 3 manganese ions, fructose-6-phosphate, and phosphate ion
SCOP Domain Sequences for d1lbyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lbyb_ e.7.1.1 (B:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Archaeoglobus fulgidus}
mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
eklhpkllelik
SCOP Domain Coordinates for d1lbyb_:
Click to download the PDB-style file with coordinates for d1lbyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lbyb_:
- d1lbyb_ is new in SCOP 1.61
- d1lbyb_ appears in SCOP 1.63
- d1lbyb_ appears in the current release, SCOPe 2.08
View in 3D
