Lineage for d1lbya_ (1lby A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2621435Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2621436Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2621437Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 2621446Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (5 species)
  7. 2621447Species Archaeoglobus fulgidus [TaxId:2234] [75608] (5 PDB entries)
  8. 2621452Domain d1lbya_: 1lby A: [73819]
    complexed with f6p, mn, po4

Details for d1lbya_

PDB Entry: 1lby (more details), 2.25 Å

PDB Description: crystal structure of a complex (p32 crystal form) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus with 3 manganese ions, fructose-6-phosphate, and phosphate ion
PDB Compounds: (A:) fructose 1,6-bisphosphatase/inositol monophosphatase

SCOPe Domain Sequences for d1lbya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbya_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeoglobus fulgidus [TaxId: 2234]}
mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
eklhpkllelik

SCOPe Domain Coordinates for d1lbya_:

Click to download the PDB-style file with coordinates for d1lbya_.
(The format of our PDB-style files is described here.)

Timeline for d1lbya_: