SCOPe 2.08: Domain d1lbya_: 1lby A:

Lineage for d1lbya_ (1lby A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
   N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet

4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families)

5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)

6. Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (5 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [75608] (5 PDB entries)

8. Domain d1lbya_: 1lby A: [73819]
   complexed with f6p, mn, po4

Details for d1lbya_

PDB Entry: 1lby, 2.25 Å

PDB Description: crystal structure of a complex (p32 crystal form) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus with 3 manganese ions, fructose-6-phosphate, and phosphate ion

PDB Compounds: (A:) fructose 1,6-bisphosphatase/inositol monophosphatase

SCOPe Domain Sequences for d1lbya_:

Sequence; same for both SEQRES and ATOM records:

>d1lbya_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeoglobus fulgidus [TaxId: 2234]}
mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
eklhpkllelik

Timeline for d1lbya_:

• d1lbya_ first appeared in SCOP 1.61
  
• d1lbya_ appears in SCOPe 2.07