Lineage for d1lb1e2 (1lb1 E:819-953)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169555Fold b.55: PH domain-like [50728] (1 superfamily)
  4. 169556Superfamily b.55.1: PH domain-like [50729] (5 families) (S)
  5. 169557Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (14 proteins)
  6. 169572Protein Dbl's big sister, Dbs [74989] (1 species)
  7. 169573Species Mouse (Mus musculus) [TaxId:10090] [74990] (3 PDB entries)
  8. 169578Domain d1lb1e2: 1lb1 E:819-953 [73791]
    Other proteins in same PDB: d1lb1a1, d1lb1b_, d1lb1c1, d1lb1d_, d1lb1e1, d1lb1f_, d1lb1g1, d1lb1h_

Details for d1lb1e2

PDB Entry: 1lb1 (more details), 2.81 Å

PDB Description: Crystal Structure of the Dbl and Pleckstrin homology domains of Dbs in complex with RhoA

SCOP Domain Sequences for d1lb1e2:

Sequence, based on SEQRES records: (download)

>d1lb1e2 b.55.1.1 (E:819-953) Dbl's big sister, Dbs {Mouse (Mus musculus)}
tgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhlflhekavlfckkree
ngegyekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawv
neirkvltsqlqacr

Sequence, based on observed residues (ATOM records): (download)

>d1lb1e2 b.55.1.1 (E:819-953) Dbl's big sister, Dbs {Mouse (Mus musculus)}
tgydgnlgdlgkllmqgsfsvwtdhkkglarfkpmqrhlflhekavlfckkreengegye
kapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawvneirkv
ltsqlqacr

SCOP Domain Coordinates for d1lb1e2:

Click to download the PDB-style file with coordinates for d1lb1e2.
(The format of our PDB-style files is described here.)

Timeline for d1lb1e2: