Lineage for d1lb1d_ (1lb1 D:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.8: G proteins [52592] (26 proteins) 
Protein RhoA [52612] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52613] (7 PDB entries) 
Domain d1lb1d_: 1lb1 D: [73789]
Other proteins in same PDB: d1lb1a1, d1lb1a2, d1lb1c1, d1lb1c2, d1lb1e1, d1lb1e2, d1lb1g1, d1lb1g2
Details for d1lb1d_
PDB Entry: 1lb1 (more details), 2.81 Å
PDB Description: crystal structure of the dbl and pleckstrin homology domains of dbs in complex with rhoa
SCOP Domain Sequences for d1lb1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lb1d_ c.37.1.8 (D:) RhoA {Human (Homo sapiens)}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
SCOP Domain Coordinates for d1lb1d_:
Click to download the PDB-style file with coordinates for d1lb1d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lb1d_:
- d1lb1d_ is new in SCOP 1.61
- d1lb1d_ appears in SCOP 1.63
- d1lb1d_ appears in the current release, SCOPe 2.08
View in 3D
