![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily) multihelical; core: 5-helical bundle |
![]() | Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) ![]() automatically mapped to Pfam PF00621 |
![]() | Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins) Pfam PF00621 |
![]() | Protein Dbl's big sister, Dbs [74743] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [74744] (4 PDB entries) Uniprot Q64096 624-958 # 98% sequence identity; the rat sequence Q63406 region 499-833 is 100% identical to the PDB sequence |
![]() | Domain d1lb1c1: 1lb1 C:624-818 [73787] Other proteins in same PDB: d1lb1a2, d1lb1b_, d1lb1c2, d1lb1d_, d1lb1e2, d1lb1f_, d1lb1g2, d1lb1h_ |
PDB Entry: 1lb1 (more details), 2.81 Å
SCOPe Domain Sequences for d1lb1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lb1c1 a.87.1.1 (C:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil gilkavndsmhliai
Timeline for d1lb1c1: