Lineage for d1lb1h_ (1lb1 H:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein RhoA [52612] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries)
    Uniprot P61586 2-181
  8. Domain d1lb1h_: 1lb1 H: [73795]
    Other proteins in same PDB: d1lb1a1, d1lb1a2, d1lb1c1, d1lb1c2, d1lb1e1, d1lb1e2, d1lb1g1, d1lb1g2

Details for d1lb1h_

PDB Entry: 1lb1 (more details), 2.81 Å

PDB Description: Crystal Structure of the Dbl and Pleckstrin homology domains of Dbs in complex with RhoA
PDB Compounds: (H:) transforming protein rhoa

SCOPe Domain Sequences for d1lb1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lb1h_ c.37.1.8 (H:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

SCOPe Domain Coordinates for d1lb1h_ are not available.

Timeline for d1lb1h_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lb1a1, d1lb1a2, d1lb1b_, d1lb1c1, d1lb1c2, d1lb1d_, d1lb1e1, d1lb1e2, d1lb1f_, d1lb1g1, d1lb1g2