Lineage for d1la6b_ (1la6 B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759014Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (4 PDB entries)
  8. 759018Domain d1la6b_: 1la6 B: [73783]
    Other proteins in same PDB: d1la6a_
    complexed with ace, cmo, hem

Details for d1la6b_

PDB Entry: 1la6 (more details), 2 Å

PDB Description: The crystal structure of Trematomus newnesi hemoglobin in a partial hemichrome state
PDB Compounds: (B:) Hemoglobin beta-1/2 chain

SCOP Domain Sequences for d1la6b_:

Sequence, based on SEQRES records: (download)

>d1la6b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflaavvsalgk

Sequence, based on observed residues (ATOM records): (download)

>d1la6b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfimsnanvaahgikvlhgl
drgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmghaftaetqgafq
kflaavvsalgk

SCOP Domain Coordinates for d1la6b_:

Click to download the PDB-style file with coordinates for d1la6b_.
(The format of our PDB-style files is described here.)

Timeline for d1la6b_: