SCOP 1.61: Domain d1la6b_: 1la6 B:

Lineage for d1la6b_ (1la6 B:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Fish (Trematomus newnesi) [TaxId:35730] [46513] (2 PDB entries)

8. Domain d1la6b_: 1la6 B: [73783]
   Other proteins in same PDB: d1la6a_

Details for d1la6b_

PDB Entry: 1la6, 2 Å

PDB Description: The crystal structure of Trematomus newnesi hemoglobin in a partial hemichrome state

SCOP Domain Sequences for d1la6b_:

Sequence, based on SEQRES records:

>d1la6b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Fish (Trematomus newnesi)}
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflaavvsalgk

Sequence, based on observed residues (ATOM records):

>d1la6b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Fish (Trematomus newnesi)}
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfimsnanvaahgikvlhgl
drgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmghaftaetqgafq
kflaavvsalgk

Timeline for d1la6b_:

• d1la6b_ is new in SCOP 1.61
  
• d1la6b_ appears in SCOP 1.63
  
• d1la6b_ appears in the current release, SCOPe 2.08