SCOPe 2.07: Domain d1l9un_: 1l9u N:

Lineage for d1l9un_ (1l9u N:)

1. Root: SCOPe 2.07

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)

7. Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)

8. Domain d1l9un_: 1l9u N: [73758]
   holoenzyme at 4 Angstrom resolution
   complexed with mg, zn

Details for d1l9un_

PDB Entry: 1l9u, 4 Å

PDB Description: thermus aquaticus rna polymerase holoenzyme at 4 a resolution

PDB Compounds: (N:) RNA polymerase, omega subunit

SCOPe Domain Sequences for d1l9un_:

Sequence; same for both SEQRES and ATOM records:

>d1l9un_ i.8.1.1 (N:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
aepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpnav
twamkelltgrlffgenlvpedrlqkemerly

Timeline for d1l9un_:

• d1l9un_ first appeared in SCOP 1.61
  
• d1l9un_ appears in SCOPe 2.06
  
• d1l9un_ appears in the current release, SCOPe 2.08