Lineage for d1l9ua_ (1l9u A:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2649260Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 2649261Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 2649262Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 2649430Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)
  7. 2649431Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)
  8. 2649437Domain d1l9ua_: 1l9u A: [73748]
    holoenzyme at 4 Angstrom resolution
    complexed with mg, zn

Details for d1l9ua_

PDB Entry: 1l9u (more details), 4 Å

PDB Description: thermus aquaticus rna polymerase holoenzyme at 4 a resolution
PDB Compounds: (A:) RNA polymerase, alpha subunit

SCOPe Domain Sequences for d1l9ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9ua_ i.8.1.1 (A:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
stipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadveimnp
dlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtr
lgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpe

SCOPe Domain Coordinates for d1l9ua_:

Click to download the PDB-style file with coordinates for d1l9ua_.
(The format of our PDB-style files is described here.)

Timeline for d1l9ua_: