| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.8: RNA polymerase [58180] (1 superfamily) |
Superfamily i.8.1: RNA polymerase [58181] (1 family) ![]() |
| Family i.8.1.1: RNA polymerase [58182] (2 proteins) |
| Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species) |
| Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries) |
| Domain d1l9un_: 1l9u N: [73758] holoenzyme at 4 Angstrom resolution complexed with mg, zn |
PDB Entry: 1l9u (more details), 4 Å
SCOPe Domain Sequences for d1l9un_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9un_ i.8.1.1 (N:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
aepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpnav
twamkelltgrlffgenlvpedrlqkemerly
Timeline for d1l9un_: