Lineage for d1l9un_ (1l9u N:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1972825Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 1972826Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 1972827Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 1972995Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)
  7. 1972996Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)
  8. 1973007Domain d1l9un_: 1l9u N: [73758]
    holoenzyme at 4 Angstrom resolution
    complexed with mg, zn

Details for d1l9un_

PDB Entry: 1l9u (more details), 4 Å

PDB Description: thermus aquaticus rna polymerase holoenzyme at 4 a resolution
PDB Compounds: (N:) RNA polymerase, omega subunit

SCOPe Domain Sequences for d1l9un_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9un_ i.8.1.1 (N:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
aepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpnav
twamkelltgrlffgenlvpedrlqkemerly

SCOPe Domain Coordinates for d1l9un_:

Click to download the PDB-style file with coordinates for d1l9un_.
(The format of our PDB-style files is described here.)

Timeline for d1l9un_: