Class b: All beta proteins [48724] (177 folds) |
Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (5 families) |
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
Protein Photosynthetic reaction centre [50348] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [50350] (84 PDB entries) Uniprot P11846 |
Domain d1l9jh1: 1l9j H:36-253 [73724] Other proteins in same PDB: d1l9jc_, d1l9jd_, d1l9jh2, d1l9jl_, d1l9jm_, d1l9jr_, d1l9js_, d1l9jt2 complexed with bcl, bph, cl, fe2, hem, lda, u10 |
PDB Entry: 1l9j (more details), 3.25 Å
SCOPe Domain Sequences for d1l9jh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9jh1 b.41.1.1 (H:36-253) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrksvva
Timeline for d1l9jh1: