Lineage for d1l9fb2 (1l9f B:218-321)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189842Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 189843Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
  5. 189899Family d.16.1.3: D-amino acid oxidase-like [54384] (2 proteins)
  6. 189937Protein Sarcosine oxidase [54388] (1 species)
  7. 189938Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (6 PDB entries)
  8. 189946Domain d1l9fb2: 1l9f B:218-321 [73719]
    Other proteins in same PDB: d1l9fa1, d1l9fb1

Details for d1l9fb2

PDB Entry: 1l9f (more details), 1.85 Å

PDB Description: Monomeric sarcosine oxidase: structure of a covalently flavinylated amine oxidizing enzyme

SCOP Domain Sequences for d1l9fb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9fb2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

SCOP Domain Coordinates for d1l9fb2:

Click to download the PDB-style file with coordinates for d1l9fb2.
(The format of our PDB-style files is described here.)

Timeline for d1l9fb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l9fb1