Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins) |
Protein Sarcosine oxidase [54388] (1 species) |
Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (9 PDB entries) |
Domain d1l9fb2: 1l9f B:218-321 [73719] Other proteins in same PDB: d1l9fa1, d1l9fb1 complexed with cl, fad, po4 |
PDB Entry: 1l9f (more details), 1.85 Å
SCOP Domain Sequences for d1l9fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9fb2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618} lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp dtinrefgvypedesnlrafleeympgangelkrgavcmytktl
Timeline for d1l9fb2: