Lineage for d1l9bh1 (1l9b H:36-253)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126036Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1126037Superfamily b.41.1: PRC-barrel domain [50346] (4 families) (S)
  5. 1126038Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 1126039Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1126040Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries)
    Uniprot P11846
  8. 1126049Domain d1l9bh1: 1l9b H:36-253 [73712]
    Other proteins in same PDB: d1l9bc_, d1l9bh2, d1l9bl_, d1l9bm_
    complexed with bcl, bph, cl, fe2, hem, hto, lda, na, u10

Details for d1l9bh1

PDB Entry: 1l9b (more details), 2.4 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type II Co-Crystals
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1l9bh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9bh1 b.41.1.1 (H:36-253) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvva

SCOPe Domain Coordinates for d1l9bh1:

Click to download the PDB-style file with coordinates for d1l9bh1.
(The format of our PDB-style files is described here.)

Timeline for d1l9bh1: